PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_45470g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family bHLH
Protein Properties Length: 154aa    MW: 18300.1 Da    PI: 9.0539
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_45470g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.69.7e-08103135133
                    CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC... CS
            HLH   1 rrrahnerErrRRdriNsafeeLrellPkaska 33 
                    +++ hn rEr RR++++  ++ Lr llP +  +
  MA_45470g0010 103 KKAFHNSRERHRRNKLKVLYSLLRLLLPDLNPE 135
                    6789************************96444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.6E-696133IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508888.918102154IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.8E-4102132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.0E-5103135IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MSTFPFFRLA HTDTYNDSDM GSLLLHSPWK ALHQPAIITP PRCWQFDHQQ LPTTDNVVLD  60
EYTRNQFGFM HEKYYHHQSP WILPVKSSEL QPNVEEYSRP ITKKAFHNSR ERHRRNKLKV  120
LYSLLRLLLP DLNPEVNPKP TFFPYCSIIL VLIL